PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0114900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 671aa    MW: 72360.5 Da    PI: 7.5418
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0114900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.5e-094815181954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Spipo2G0114900 481 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 518
                     554458******************************88 PP

2BELL124.73.6e-40342412272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     r e+q++kakLls+l+eVd+rY++y+eq+q+v++sF+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  Spipo2G0114900 342 RFEHQRRKAKLLSMLDEVDRRYNHYCEQMQMVVNSFDSVMGAGAATPYTALAQKAMSRHFRCLKDAIAAQL 412
                     779*****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-69264410IPR006563POX domain
PfamPF075263.7E-53269409IPR006563POX domain
PROSITE profilePS5007112.357459522IPR001356Homeobox domain
CDDcd000861.05E-12462523No hitNo description
SMARTSM003891.2E-8462526IPR001356Homeobox domain
SuperFamilySSF466894.06E-17464530IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-28465528IPR009057Homeodomain-like
PfamPF059203.3E-18479518IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 671 aa     Download sequence    Send to blast
MSQGFHQGIF SFSDGFDRTP HAAATRQQQQ QQHLAQQSRR DKLRVQGFDP SGAPLVSLDD  60
VAEPIYEPAG GGNMLSDMFN FSAAAGPSST DLLASQIAPN FRPQRPPAAG FSGDWYGGGN  120
NREGLAMGGG LASPVDIPKP QVGDPPRHHQ LSGMNADSAA AMHMFLMNPL QQPQRSASPP  180
PPDPSAFQTQ SFGNSSFGGG MVEGQGLSLS LSSSLQQLEM ARAEELRYYG GQQQQQPRQL  240
HFQGQPGQLG LSQHVQHVGF GSSAGVVNML RNSKYARAAQ ELLEEFCGVA RGQLKGSKKG  300
RHSGSAANRN PSSAGGSAST SSAPAGSSSS TKEPPTLSPA DRFEHQRRKA KLLSMLDEVD  360
RRYNHYCEQM QMVVNSFDSV MGAGAATPYT ALAQKAMSRH FRCLKDAIAA QLKNTCDLLG  420
EKDGAGSTGI TKGETPRLRL LEQSLRQQRA FHQIGMMEQE AWRPQRGLPE RSVNILRGWL  480
FEHFLHPYPS DADKHLLARQ TGLSRNQVSN WFINARVRLW KPMVEEMYQQ ESKDLTDDGE  540
REEGRSESPK QQQQQQEQQK NQPPPPLEPS IGATDGDPSQ PQFTASEGLT GLPLGRPLGG  600
AGDVASLVGM DALPMGDLGP TDDIRAAIAS SAAARRRYGA SGDVSLTLGL RHAGNMPEGG  660
RFSIRDFGDS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B3e-16468525158Homeobox protein Meis1
4xrs_A3e-16468525158Homeobox protein Meis1
3k2a_B3e-16468526563Homeobox protein Meis2
3k2a_A3e-16468526563Homeobox protein Meis2
4xrm_B4e-16468526563Homeobox protein Meis2
4xrm_A4e-16468526563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395654.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLM0TL800.0M0TL80_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P27440_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-127BEL1-like homeodomain 2